PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR10G14090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 387aa    MW: 40147.3 Da    PI: 7.6578
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR10G14090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.5e-18287322136
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l+
  LPERR10G14090.1 287 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLM 322
                      ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-16281331IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.227285317IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-14285345No hitNo description
Gene3DG3DSA:3.30.50.102.5E-13285319IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.25E-13286333No hitNo description
PROSITE patternPS003440287312IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15287322IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASEWEMAMG GGVDLGMGMS TYHHHHNASS AAAIAAAPTM MSHHHHHHGA VGGGYSASAA  60
AAHHHHYYGM PPPAMGDAMR VDELLDLSNT PGAHDFFPAS AAAAGDNNNG HHHHHHHVSA  120
MGGEPSGTTS SDHQTSMLSF ADDFYIPTEE AAELEWLSKF VDDSYSDMPN YHSSAHAAMA  180
AAAAAANNAG GSSAGGQDSC LTAAAPGRGA RSKRSRATAA AAAAWHSLVP RPASNSSPSS  240
SSCSSSDFPS SNKDAAAAAR PRGSGKKSPG PAAAAAEVGM EGGVRRCTHC ASEKTPQWRT  300
GPLGPKTLCN ACGVRFKSGR LMPEYRPAAS PTFVLTQHSN SHRKVMELRR QKELIVIRGS  360
HRDAASAAHA AAAGGRPELM FRDYGVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8378193e-96CT837819.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN064N24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983678.11e-152PREDICTED: GATA transcription factor 2-like
TrEMBLA0A0D9XMB90.0A0A0D9XMB9_9ORYZ; Uncharacterized protein
STRINGSi036273m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.13e-44GATA transcription factor 2